SCOPe 2.06: Domain d5guda2: 5gud A:198-447

Lineage for d5guda2 (5gud A:198-447)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (239 species)
   not a true protein

7. Species Corynebacterium glutamicum [TaxId:1718] [188585] (2 PDB entries)

8. Domain d5guda2: 5gud A:198-447 [335065]
   Other proteins in same PDB: d5guda1, d5gudb1, d5gudc1, d5gudd1, d5gudf1
   automated match to d3r3ja2
   complexed with 2it, cit, k, ndp

Details for d5guda2

PDB Entry: 5gud, 1.68 Å

PDB Description: glutamate dehydrogenase from corynebacterium glutamicum (alpha- iminoglutarate/nadp+ complex)

PDB Compounds: (A:) glutamate dehydrogenase

SCOPe Domain Sequences for d5guda2:

Sequence; same for both SEQRES and ATOM records:

>d5guda2 c.2.1.0 (A:198-447) automated matches {Corynebacterium glutamicum [TaxId: 1718]}
kgltwggslvrteatgygcvyfvsemikakgesisgqkiivsgsgnvatyaiekaqelga
tvigfsdssgwvhtpngvdvaklreikevrrarvsvyadeiegatyhtdgsiwdlkcdia
lpcatqnelngenaktladngcrfvaeganmpstpeavevfrerdirfgpgkaanaggva
tsalemqqnasrdswsfeytderlqvimknifktcaetaaeyghendyvvganiagfkkv
adamlaqgvi

Timeline for d5guda2:

• d5guda2 is new in SCOPe 2.06-stable
  
• d5guda2 appears in SCOPe 2.07
  
• d5guda2 appears in the current release, SCOPe 2.08