| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
| Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
| Protein automated matches [190069] (319 species) not a true protein |
| Species Corynebacterium glutamicum [TaxId:1718] [188585] (2 PDB entries) |
| Domain d5guda2: 5gud A:198-447 [335065] Other proteins in same PDB: d5guda1, d5gudb1, d5gudc1, d5gudd1, d5gudf1 automated match to d3r3ja2 complexed with 2it, cit, k, ndp |
PDB Entry: 5gud (more details), 1.68 Å
SCOPe Domain Sequences for d5guda2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5guda2 c.2.1.0 (A:198-447) automated matches {Corynebacterium glutamicum [TaxId: 1718]}
kgltwggslvrteatgygcvyfvsemikakgesisgqkiivsgsgnvatyaiekaqelga
tvigfsdssgwvhtpngvdvaklreikevrrarvsvyadeiegatyhtdgsiwdlkcdia
lpcatqnelngenaktladngcrfvaeganmpstpeavevfrerdirfgpgkaanaggva
tsalemqqnasrdswsfeytderlqvimknifktcaetaaeyghendyvvganiagfkkv
adamlaqgvi
Timeline for d5guda2: