Lineage for d5guda2 (5gud A:198-447)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2846644Species Corynebacterium glutamicum [TaxId:1718] [188585] (2 PDB entries)
  8. 2846645Domain d5guda2: 5gud A:198-447 [335065]
    Other proteins in same PDB: d5guda1, d5gudb1, d5gudc1, d5gudd1, d5gudf1
    automated match to d3r3ja2
    complexed with 2it, cit, k, ndp

Details for d5guda2

PDB Entry: 5gud (more details), 1.68 Å

PDB Description: glutamate dehydrogenase from corynebacterium glutamicum (alpha- iminoglutarate/nadp+ complex)
PDB Compounds: (A:) glutamate dehydrogenase

SCOPe Domain Sequences for d5guda2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5guda2 c.2.1.0 (A:198-447) automated matches {Corynebacterium glutamicum [TaxId: 1718]}
kgltwggslvrteatgygcvyfvsemikakgesisgqkiivsgsgnvatyaiekaqelga
tvigfsdssgwvhtpngvdvaklreikevrrarvsvyadeiegatyhtdgsiwdlkcdia
lpcatqnelngenaktladngcrfvaeganmpstpeavevfrerdirfgpgkaanaggva
tsalemqqnasrdswsfeytderlqvimknifktcaetaaeyghendyvvganiagfkkv
adamlaqgvi

SCOPe Domain Coordinates for d5guda2:

Click to download the PDB-style file with coordinates for d5guda2.
(The format of our PDB-style files is described here.)

Timeline for d5guda2: