![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily) core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134 |
![]() | Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families) ![]() |
![]() | Family c.58.1.0: automated matches [227157] (1 protein) not a true family |
![]() | Protein automated matches [226864] (40 species) not a true protein |
![]() | Species Corynebacterium glutamicum [TaxId:1718] [335048] (1 PDB entry) |
![]() | Domain d5gudb1: 5gud B:2-197 [335056] Other proteins in same PDB: d5guda2, d5gudb2, d5gudc2, d5gudd2, d5gudf2 automated match to d3r3ja1 complexed with 2it, cit, k, ndp |
PDB Entry: 5gud (more details), 1.68 Å
SCOPe Domain Sequences for d5gudb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5gudb1 c.58.1.0 (B:2-197) automated matches {Corynebacterium glutamicum [TaxId: 1718]} tvdeqvsnyydmllkrnagepefhqavaevleslkivlekdphyadygliqrlceperql ifrvpwvddqgqvhvnrgfrvqfnsalgpykgglrfhpsvnlgivkflgfeqifknsltg lpigggkggsdfdpkgksdleimrfcqsfmtelhrhigeyrdvpagdigvggreigylfg hyrrmanqhesgvltg
Timeline for d5gudb1: