Lineage for d5gudd1 (5gud D:1-197)
- Root: SCOPe 2.07
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families) 
Family c.58.1.0: automated matches [227157] (1 protein)
not a true familyProtein automated matches [226864] (38 species)
not a true protein
Species Corynebacterium glutamicum [TaxId:1718] [335048] (1 PDB entry) 
Domain d5gudd1: 5gud D:1-197 [335055]
Other proteins in same PDB: d5guda2, d5gudb2, d5gudc2, d5gudd2, d5gudf2
automated match to d3r3ja1
complexed with 2it, cit, k, ndp
Details for d5gudd1
PDB Entry: 5gud (more details), 1.68 Å
PDB Description: glutamate dehydrogenase from corynebacterium glutamicum (alpha- iminoglutarate/nadp+ complex)
PDB Compounds: (D:) glutamate dehydrogenaseSCOPe Domain Sequences for d5gudd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5gudd1 c.58.1.0 (D:1-197) automated matches {Corynebacterium glutamicum [TaxId: 1718]}
mtvdeqvsnyydmllkrnagepefhqavaevleslkivlekdphyadygliqrlceperq
lifrvpwvddqgqvhvnrgfrvqfnsalgpykgglrfhpsvnlgivkflgfeqifknslt
glpigggkggsdfdpkgksdleimrfcqsfmtelhrhigeyrdvpagdigvggreigylf
ghyrrmanqhesgvltg
SCOPe Domain Coordinates for d5gudd1:
Click to download the PDB-style file with coordinates for d5gudd1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d5gudd1:
View in 3D
