Lineage for d5gudd1 (5gud D:1-197)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2890282Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
    core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134
  4. 2890283Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families) (S)
  5. 2890629Family c.58.1.0: automated matches [227157] (1 protein)
    not a true family
  6. 2890630Protein automated matches [226864] (40 species)
    not a true protein
  7. 2890683Species Corynebacterium glutamicum [TaxId:1718] [335048] (1 PDB entry)
  8. 2890687Domain d5gudd1: 5gud D:1-197 [335055]
    Other proteins in same PDB: d5guda2, d5gudb2, d5gudc2, d5gudd2, d5gudf2
    automated match to d3r3ja1
    complexed with 2it, cit, k, ndp

Details for d5gudd1

PDB Entry: 5gud (more details), 1.68 Å

PDB Description: glutamate dehydrogenase from corynebacterium glutamicum (alpha- iminoglutarate/nadp+ complex)
PDB Compounds: (D:) glutamate dehydrogenase

SCOPe Domain Sequences for d5gudd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gudd1 c.58.1.0 (D:1-197) automated matches {Corynebacterium glutamicum [TaxId: 1718]}
mtvdeqvsnyydmllkrnagepefhqavaevleslkivlekdphyadygliqrlceperq
lifrvpwvddqgqvhvnrgfrvqfnsalgpykgglrfhpsvnlgivkflgfeqifknslt
glpigggkggsdfdpkgksdleimrfcqsfmtelhrhigeyrdvpagdigvggreigylf
ghyrrmanqhesgvltg

SCOPe Domain Coordinates for d5gudd1:

Click to download the PDB-style file with coordinates for d5gudd1.
(The format of our PDB-style files is described here.)

Timeline for d5gudd1: