Lineage for d5kb6b_ (5kb6 B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2904325Fold c.72: Ribokinase-like [53612] (3 superfamilies)
    core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
    potential superfamily: members of this fold have similar functions but different ATP-binding sites
  4. 2904326Superfamily c.72.1: Ribokinase-like [53613] (6 families) (S)
    has extra strand located between strands 2 and 3
  5. 2904327Family c.72.1.1: Ribokinase-like [53614] (10 proteins)
    automatically mapped to Pfam PF00294
  6. 2904349Protein Adenosine kinase [53617] (3 species)
  7. 2904360Species Mouse (Mus musculus) [TaxId:10090] [335051] (2 PDB entries)
  8. 2904362Domain d5kb6b_: 5kb6 B: [335054]
    automated match to d4o1lb_
    complexed with act, adn, cl, pg4, so4

Details for d5kb6b_

PDB Entry: 5kb6 (more details), 1.2 Å

PDB Description: high-resolution structure of the adenosine kinase from mus musculus in complex with adenosine
PDB Compounds: (B:) adenosine kinase

SCOPe Domain Sequences for d5kb6b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5kb6b_ c.72.1.1 (B:) Adenosine kinase {Mouse (Mus musculus) [TaxId: 10090]}
alsenvlfgmgnplldisavvdkdfldkyslkpndqilaedkhkelfdelvkkfkveyha
ggstqnsmkvaqwliqephkaatffgcigidkfgeilkrkaadahvdahyyeqneqptgt
caacitggnrslvanlaaancykkekhldlernwvlvekarvyyiagffltvspesvlkv
aryaaennrvftlnlsapfisqffkealmdvmpyvdilfgneteaatfareqgfetkdik
eiakkaqalpkvnskrqrtviftqgrddtivaaendvtafpvldqnqeeiidtngagdaf
vggflsqlvsdkplteciraghyaasviirrtgctfpekpdfh

SCOPe Domain Coordinates for d5kb6b_:

Click to download the PDB-style file with coordinates for d5kb6b_.
(The format of our PDB-style files is described here.)

Timeline for d5kb6b_: