Lineage for d5vvwg2 (5vvw G:104-319)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2904325Fold c.72: Ribokinase-like [53612] (3 superfamilies)
    core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
    potential superfamily: members of this fold have similar functions but different ATP-binding sites
  4. 2904995Superfamily c.72.2: MurD-like peptide ligases, catalytic domain [53623] (3 families) (S)
    has extra strand located between strands 1 and 2
  5. 2905053Family c.72.2.0: automated matches [254328] (1 protein)
    not a true family
  6. 2905054Protein automated matches [254749] (4 species)
    not a true protein
  7. 2905060Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [271624] (6 PDB entries)
  8. 2905085Domain d5vvwg2: 5vvw G:104-319 [335017]
    Other proteins in same PDB: d5vvwa1, d5vvwa3, d5vvwb1, d5vvwb3, d5vvwc1, d5vvwc3, d5vvwd1, d5vvwd3, d5vvwe1, d5vvwe3, d5vvwf1, d5vvwf3, d5vvwg1, d5vvwg3, d5vvwh1, d5vvwh3
    automated match to d4hv4a2
    complexed with edo

Details for d5vvwg2

PDB Entry: 5vvw (more details), 2.3 Å

PDB Description: structure of murc from pseudomonas aeruginosa
PDB Compounds: (G:) UDP-N-acetylmuramate--L-alanine ligase

SCOPe Domain Sequences for d5vvwg2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vvwg2 c.72.2.0 (G:104-319) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
raemlaelmryrhgiavagthgkttttsliasvfaaggldptfviggrlnaagtnaqlga
srylvaeadesdasflhlqpmvavvtnidadhmatyggdfnklkktfveflhnlpfygla
vmcvddpvvreilpqiarptvtyglsedadvrainirqegmrtwftvlrperepldvsvn
mpglhnvlnslativiatdegisdeaivqglsgfqg

SCOPe Domain Coordinates for d5vvwg2:

Click to download the PDB-style file with coordinates for d5vvwg2.
(The format of our PDB-style files is described here.)

Timeline for d5vvwg2: