SCOPe 2.08: Domain d5n17b1: 5n17 B:193-319

Lineage for d5n17b1 (5n17 B:193-319)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.2: Bromodomain [47370] (2 families)

5. Family a.29.2.0: automated matches [191428] (1 protein)
   not a true family

6. Protein automated matches [190615] (15 species)
   not a true protein

7. Species Yeast (Candida albicans) [TaxId:5476] [334873] (4 PDB entries)

8. Domain d5n17b1: 5n17 B:193-319 [335013]
   Other proteins in same PDB: d5n17a2, d5n17b2
   automated match to d5c4qb_
   complexed with 8fk, so4

Details for d5n17b1

PDB Entry: 5n17, 1.6 Å

PDB Description: first bromodomain (bd1) from candida albicans bdf1 bound to a dibenzothiazepinone (compound 3)

PDB Compounds: (B:) Bromodomain-containing factor 1

SCOPe Domain Sequences for d5n17b1:

Sequence; same for both SEQRES and ATOM records:

>d5n17b1 a.29.2.0 (B:193-319) automated matches {Yeast (Candida albicans) [TaxId: 5476]}
apkppqepdmnnlpenpipqhqakfvlntikavkrnreavpflhpvdtvklnvpfyynyi
prpmdlstierkinlkayedvsqvvddfnlmvknckkfngeaagiskmatniqaqfeklm
vkvppke

Timeline for d5n17b1:

• d5n17b1 first appeared in SCOPe 2.06
  
• d5n17b1 appears in SCOPe 2.07