SCOPe 2.08: Domain d5xm5a_: 5xm5 A:

Lineage for d5xm5a_ (5xm5 A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.4: Hypothetical protein YodA [101863] (2 proteins)
   bacterial metal-binding, lipocalin-like protein
   automatically mapped to Pfam PF09223

6. Protein Hypothetical protein YodA [101864] (3 species)

7. Species Escherichia coli [TaxId:83333] [335010] (1 PDB entry)

8. Domain d5xm5a_: 5xm5 A: [335011]
   automated match to d1oeja_
   complexed with na, zn

Details for d5xm5a_

PDB Entry: 5xm5, 1.49 Å

PDB Description: crystal structure of zinc binding protein zint at 1.49 angstrom from e. coli

PDB Compounds: (A:) metal-binding protein zint

SCOPe Domain Sequences for d5xm5a_:

Sequence; same for both SEQRES and ATOM records:

>d5xm5a_ b.60.1.4 (A:) Hypothetical protein YodA {Escherichia coli [TaxId: 83333]}
gkplteveqkaangvfddanvqnrtlsdwdgvwqsvypllqsgkldpvfqkkadadktkt
faeikdyyhkgyatdiemigiedgivefhrnnettsckydydgykiltyksgkkgvrylf
eckdpeskapkyiqfsdhiiaprksshfhifmgndsqqsllnemenwptyypyqlsseev
veemmsh

Timeline for d5xm5a_:

• d5xm5a_ first appeared in SCOPe 2.06
  
• d5xm5a_ appears in SCOPe 2.07