SCOPe 2.06: Domain d5wseb1: 5wse B:1-114

Lineage for d5wseb1 (5wse B:1-114)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (25 families)

5. Family b.82.1.10: TM1459-like [101976] (3 proteins)

6. Protein automated matches [334958] (1 species)
   not a true protein

7. Species Thermotoga maritima [TaxId:243274] [334959] (3 PDB entries)

8. Domain d5wseb1: 5wse B:1-114 [335008]
   Other proteins in same PDB: d5wseb2
   automated match to d1vj2a_
   complexed with os

Details for d5wseb1

PDB Entry: 5wse, 1.12 Å

PDB Description: crystal structure of a cupin protein (tm1459) in osmium (os) substituted form i

PDB Compounds: (B:) Uncharacterized protein tm1459

SCOPe Domain Sequences for d5wseb1:

Sequence; same for both SEQRES and ATOM records:

>d5wseb1 b.82.1.10 (B:1-114) automated matches {Thermotoga maritima [TaxId: 243274]}
milkraydvtpqkistdkvrgvrkrvliglkdapnfvmrlftvepgglidrhshpwehei
fvlkgkltvlkeqgeetveegfyifvepneihgfrndtdseveflclipkegge

Timeline for d5wseb1:

• d5wseb1 is new in SCOPe 2.06-stable
  
• d5wseb1 appears in SCOPe 2.07
  
• d5wseb1 appears in the current release, SCOPe 2.08