Lineage for d5vcea_ (5vce A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2330957Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2330958Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2330959Family a.104.1.1: Cytochrome P450 [48265] (23 protein domains)
  6. 2331534Protein automated matches [190068] (8 species)
    not a true protein
  7. 2331553Species Human (Homo sapiens) [TaxId:9606] [189507] (50 PDB entries)
  8. 2331571Domain d5vcea_: 5vce A: [335004]
    automated match to d1w0ea_
    complexed with hem, rit

Details for d5vcea_

PDB Entry: 5vce (more details), 2.2 Å

PDB Description: crystal structure of the cysteine depleted cyp3a4 bound to ritonavir
PDB Compounds: (A:) cytochrome p450 3a4

SCOPe Domain Sequences for d5vcea_:

Sequence, based on SEQRES records: (download)

>d5vcea_ a.104.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gthshglfkklgipgptplpflgnilsyhkgfamfdmemhkkygkvwgfydgqqpvlait
dpdmiktvlvkeaysvftnrrpfgpvgfmksaisiaedeewkrlrsllsptftsgklkem
vpiiaqygdvlvrnlrreaetgkpvtlkdvfgaysmdvitstsfgvnidslnnpqdpfve
ntkkllrfdfldpfflsitvfpflipilevlnitvfprevtnflrksvkrmkesrledtq
khrvdflqlmidsqnsketeshkalsdlelvaqsiififagyettssvlsfimyelathp
dvqqklqeeidavlpnkapptydtvlqmeyldmvvnetlrlfpiamrlervakkdveing
mfipkgvvvmipsyalhrdpkywtepekflperfskknkdnidpyiytpfgsgprncigm
rfalmnmklalirvlqnfsfkpsketqiplklslggllqpekpvvlkvesr

Sequence, based on observed residues (ATOM records): (download)

>d5vcea_ a.104.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gthshglfkklgipgptplpflgnilsyhkgfamfdmemhkkygkvwgfydgqqpvlait
dpdmiktvlvkeaysvftnrrpfgpvgfmksaisiaedeewkrlrsllsptftsgklkem
vpiiaqygdvlvrnlrreaetgkpvtlkdvfgaysmdvitstsfgvnidslnnpqdpfve
ntkkllrfdfldpfflsitvfpflipilevlnitvfprevtnflrksvkrmkesrrvdfl
qlmidsqnkalsdlelvaqsiififagyettssvlsfimyelathpdvqqklqeeidavl
pnkapptydtvlqmeyldmvvnetlrlfpiamrlervakkdveingmfipkgvvvmipsy
alhrdpkywtepekflperfskknkdnidpyiytpfgsgprncigmrfalmnmklalirv
lqnfsfkpsketqiplklslggllqpekpvvlkvesr

SCOPe Domain Coordinates for d5vcea_:

Click to download the PDB-style file with coordinates for d5vcea_.
(The format of our PDB-style files is described here.)

Timeline for d5vcea_: