SCOPe 2.06: Domain d5uroa1: 5uro A:1-335

Lineage for d5uroa1 (5uro A:1-335)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.0: automated matches [191404] (1 protein)
   not a true family

6. Protein automated matches [190543] (91 species)
   not a true protein

7. Species Hypocrea jecorina [TaxId:431241] [334994] (1 PDB entry)

8. Domain d5uroa1: 5uro A:1-335 [334995]
   Other proteins in same PDB: d5uroa2
   automated match to d4c4za_
   complexed with 8ld

Details for d5uroa1

PDB Entry: 5uro, 1.7 Å

PDB Description: structure of a soluble epoxide hydrolase identified in trichoderma reesei

PDB Compounds: (A:) Predicted protein

SCOPe Domain Sequences for d5uroa1:

Sequence; same for both SEQRES and ATOM records:

>d5uroa1 c.69.1.0 (A:1-335) automated matches {Hypocrea jecorina [TaxId: 431241]}
mdtsklkpndprvkyetkqirgktysyilgepagpkletvvlvhgwpdmafgwrhqipyl
mslgfqvvapnmlgyagtdaprdlsqftlksvsadiaelarsfvgqdgqivlgghdwgga
vvwrtayyhpelvkavfsvctplhplsaeykpledivaaghmlnfkyqlqlkgpdveari
qgkdmlrrfframfggrgpngeagfstsdgvhfdvldkigapplldeqeleyyveqyalq
eapelrgplnwyrtrelnakdemdrakngpplrfempalfvaaskdnalppamskgmdaf
ykdltraevdathwaltqagdevnrvigewlnkal

Timeline for d5uroa1:

• d5uroa1 is new in SCOPe 2.06-stable
  
• d5uroa1 appears in SCOPe 2.07
  
• d5uroa1 appears in the current release, SCOPe 2.08