Lineage for d5uroa1 (5uro A:1-335)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2899459Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2899460Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2901917Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2901918Protein automated matches [190543] (131 species)
    not a true protein
  7. 2902424Species Hypocrea jecorina [TaxId:431241] [334994] (1 PDB entry)
  8. 2902425Domain d5uroa1: 5uro A:1-335 [334995]
    Other proteins in same PDB: d5uroa2
    automated match to d4c4za_
    complexed with 8ld

Details for d5uroa1

PDB Entry: 5uro (more details), 1.7 Å

PDB Description: structure of a soluble epoxide hydrolase identified in trichoderma reesei
PDB Compounds: (A:) Predicted protein

SCOPe Domain Sequences for d5uroa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5uroa1 c.69.1.0 (A:1-335) automated matches {Hypocrea jecorina [TaxId: 431241]}
mdtsklkpndprvkyetkqirgktysyilgepagpkletvvlvhgwpdmafgwrhqipyl
mslgfqvvapnmlgyagtdaprdlsqftlksvsadiaelarsfvgqdgqivlgghdwgga
vvwrtayyhpelvkavfsvctplhplsaeykpledivaaghmlnfkyqlqlkgpdveari
qgkdmlrrfframfggrgpngeagfstsdgvhfdvldkigapplldeqeleyyveqyalq
eapelrgplnwyrtrelnakdemdrakngpplrfempalfvaaskdnalppamskgmdaf
ykdltraevdathwaltqagdevnrvigewlnkal

SCOPe Domain Coordinates for d5uroa1:

Click to download the PDB-style file with coordinates for d5uroa1.
(The format of our PDB-style files is described here.)

Timeline for d5uroa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5uroa2