Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (239 species) not a true protein |
Species Brucella melitensis [TaxId:224914] [236934] (2 PDB entries) |
Domain d5vn2d_: 5vn2 D: [334984] Other proteins in same PDB: d5vn2b2, d5vn2c2 automated match to d4onea_ complexed with act, edo, nad |
PDB Entry: 5vn2 (more details), 1.9 Å
SCOPe Domain Sequences for d5vn2d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5vn2d_ c.2.1.0 (D:) automated matches {Brucella melitensis [TaxId: 224914]} srqrpvalvtggrrgiglgiaralaakgfdlaitdresdeavihelrglggkvaffksdl aavktheatvfavldafggidclvnnagmgavergdflalkpenfdtimdvnlrgtvfft qavvkamlaadevrfprsivtissvssvmtsperldyciskagltafvqglalrlaeari gvfevrpgiirtdmtakvaarydaliegglvpmkrwgeasdvgaivaglaggdfifatgs aihadgglsiakl
Timeline for d5vn2d_: