SCOPe 2.07: Domain d5vvwd2: 5vvw D:104-319

Lineage for d5vvwd2 (5vvw D:104-319)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.72: Ribokinase-like [53612] (3 superfamilies)
   core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
   potential superfamily: members of this fold have similar functions but different ATP-binding sites

4. Superfamily c.72.2: MurD-like peptide ligases, catalytic domain [53623] (3 families)
   has extra strand located between strands 1 and 2

5. Family c.72.2.0: automated matches [254328] (1 protein)
   not a true family

6. Protein automated matches [254749] (4 species)
   not a true protein

7. Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [271624] (6 PDB entries)

8. Domain d5vvwd2: 5vvw D:104-319 [334981]
   Other proteins in same PDB: d5vvwa1, d5vvwa3, d5vvwb1, d5vvwb3, d5vvwc1, d5vvwc3, d5vvwd1, d5vvwd3, d5vvwe1, d5vvwe3, d5vvwf1, d5vvwf3, d5vvwg1, d5vvwg3, d5vvwh1, d5vvwh3
   automated match to d4hv4a2
   complexed with edo

Details for d5vvwd2

PDB Entry: 5vvw, 2.3 Å

PDB Description: structure of murc from pseudomonas aeruginosa

PDB Compounds: (D:) UDP-N-acetylmuramate--L-alanine ligase

SCOPe Domain Sequences for d5vvwd2:

Sequence; same for both SEQRES and ATOM records:

>d5vvwd2 c.72.2.0 (D:104-319) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
raemlaelmryrhgiavagthgkttttsliasvfaaggldptfviggrlnaagtnaqlga
srylvaeadesdasflhlqpmvavvtnidadhmatyggdfnklkktfveflhnlpfygla
vmcvddpvvreilpqiarptvtyglsedadvrainirqegmrtwftvlrperepldvsvn
mpglhnvlnslativiatdegisdeaivqglsgfqg

Timeline for d5vvwd2:

• d5vvwd2 first appeared in SCOPe 2.06
  
• d5vvwd2 appears in the current release, SCOPe 2.08