![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
![]() | Superfamily b.82.1: RmlC-like cupins [51182] (25 families) ![]() |
![]() | Family b.82.1.10: TM1459-like [101976] (3 protein domains) |
![]() | Protein automated matches [334958] (1 species) not a true protein |
![]() | Species Thermotoga maritima [TaxId:243274] [334959] (3 PDB entries) |
![]() | Domain d5wsfd_: 5wsf D: [334977] automated match to d1vj2a_ complexed with os |
PDB Entry: 5wsf (more details), 1.11 Å
SCOPe Domain Sequences for d5wsfd_:
Sequence, based on SEQRES records: (download)
>d5wsfd_ b.82.1.10 (D:) automated matches {Thermotoga maritima [TaxId: 243274]} milkraydvtpqkistdkvrgvrkrvliglkdapnfvmrlftvepgglidrhshpwehei fvlkgkltvlkeqgeetveegfyifvepneihgfrndtdseveflclipkegge
>d5wsfd_ b.82.1.10 (D:) automated matches {Thermotoga maritima [TaxId: 243274]} milkraydvtpqkvrgvrkrvliglkdapnfvmrlftvepgglidrhshpweheifvlkg kltvlkeqgeetveegfyifvepneihgfrndtdseveflclipkegge
Timeline for d5wsfd_: