SCOPe 2.07: Domain d5wsfd_: 5wsf D:

Lineage for d5wsfd_ (5wsf D:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (25 families)

5. Family b.82.1.10: TM1459-like [101976] (3 protein domains)

6. Protein automated matches [334958] (1 species)
   not a true protein

7. Species Thermotoga maritima [TaxId:243274] [334959] (3 PDB entries)

8. Domain d5wsfd_: 5wsf D: [334977]
   automated match to d1vj2a_
   complexed with os

Details for d5wsfd_

PDB Entry: 5wsf, 1.11 Å

PDB Description: crystal structure of a cupin protein (tm1459) in osmium (os)- substituted form ii

PDB Compounds: (D:) Uncharacterized protein tm1459

SCOPe Domain Sequences for d5wsfd_:

Sequence, based on SEQRES records:

>d5wsfd_ b.82.1.10 (D:) automated matches {Thermotoga maritima [TaxId: 243274]}
milkraydvtpqkistdkvrgvrkrvliglkdapnfvmrlftvepgglidrhshpwehei
fvlkgkltvlkeqgeetveegfyifvepneihgfrndtdseveflclipkegge

Sequence, based on observed residues (ATOM records):

>d5wsfd_ b.82.1.10 (D:) automated matches {Thermotoga maritima [TaxId: 243274]}
milkraydvtpqkvrgvrkrvliglkdapnfvmrlftvepgglidrhshpweheifvlkg
kltvlkeqgeetveegfyifvepneihgfrndtdseveflclipkegge

Timeline for d5wsfd_:

• d5wsfd_ first appeared in SCOPe 2.06