| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
Superfamily a.29.2: Bromodomain [47370] (2 families) ![]() |
| Family a.29.2.0: automated matches [191428] (1 protein) not a true family |
| Protein automated matches [190615] (15 species) not a true protein |
| Species Yeast (Candida albicans) [TaxId:5476] [334873] (4 PDB entries) |
| Domain d5n17a1: 5n17 A:193-318 [334975] Other proteins in same PDB: d5n17a2, d5n17b2 automated match to d5c4qb_ complexed with 8fk, so4 |
PDB Entry: 5n17 (more details), 1.6 Å
SCOPe Domain Sequences for d5n17a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5n17a1 a.29.2.0 (A:193-318) automated matches {Yeast (Candida albicans) [TaxId: 5476]}
apkppqepdmnnlpenpipqhqakfvlntikavkrnreavpflhpvdtvklnvpfyynyi
prpmdlstierkinlkayedvsqvvddfnlmvknckkfngeaagiskmatniqaqfeklm
vkvppk
Timeline for d5n17a1: