Lineage for d5wsdb_ (5wsd B:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2403751Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2403752Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 2404088Family b.82.1.10: TM1459-like [101976] (3 protein domains)
  6. 2404131Protein automated matches [334958] (1 species)
    not a true protein
  7. 2404132Species Thermotoga maritima [TaxId:243274] [334959] (3 PDB entries)
  8. 2404142Domain d5wsdb_: 5wsd B: [334974]
    Other proteins in same PDB: d5wsda2
    automated match to d1vj2a_

Details for d5wsdb_

PDB Entry: 5wsd (more details), 1.2 Å

PDB Description: crystal structure of a cupin protein (tm1459) in apo form
PDB Compounds: (B:) Uncharacterized protein tm1459

SCOPe Domain Sequences for d5wsdb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5wsdb_ b.82.1.10 (B:) automated matches {Thermotoga maritima [TaxId: 243274]}
milkraydvtpqkistdkvrgvrkrvliglkdapnfvmrlftvepgglidrhshpwehei
fvlkgkltvlkeqgeetveegfyifvepneihgfrndtdseveflclipkegge

SCOPe Domain Coordinates for d5wsdb_:

Click to download the PDB-style file with coordinates for d5wsdb_.
(The format of our PDB-style files is described here.)

Timeline for d5wsdb_: