| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
Superfamily a.29.2: Bromodomain [47370] (2 families) ![]() |
| Family a.29.2.0: automated matches [191428] (1 protein) not a true family |
| Protein automated matches [190615] (10 species) not a true protein |
| Species Candida albicans [TaxId:237561] [334871] (1 PDB entry) |
| Domain d5n18a1: 5n18 A:386-489 [334972] Other proteins in same PDB: d5n18a2, d5n18b2 automated match to d2dwwa_ complexed with 8hz, gol |
PDB Entry: 5n18 (more details), 1.45 Å
SCOPe Domain Sequences for d5n18a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5n18a1 a.29.2.0 (A:386-489) automated matches {Candida albicans [TaxId: 237561]}
aaelrfcnqtikelmskkhynynfpflapvdtvalnipnyneivkqpmdlgtiqsklann
eyenaddfekdvrlvfkncylfnpegtdvnmmghrleavfdkkw
Timeline for d5n18a1: