SCOPe 2.08: Domain d5n18a1: 5n18 A:386-489

Lineage for d5n18a1 (5n18 A:386-489)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.2: Bromodomain [47370] (2 families)

5. Family a.29.2.0: automated matches [191428] (1 protein)
   not a true family

6. Protein automated matches [190615] (15 species)
   not a true protein

7. Species Candida albicans [TaxId:237561] [334871] (1 PDB entry)

8. Domain d5n18a1: 5n18 A:386-489 [334972]
   Other proteins in same PDB: d5n18a2, d5n18b2
   automated match to d2dwwa_
   complexed with 8hz, gol

Details for d5n18a1

PDB Entry: 5n18, 1.45 Å

PDB Description: second bromodomain (bd2) from candida albicans bdf1 bound to an imidazopyridine (compound 2)

PDB Compounds: (A:) Bromodomain-containing factor 1

SCOPe Domain Sequences for d5n18a1:

Sequence; same for both SEQRES and ATOM records:

>d5n18a1 a.29.2.0 (A:386-489) automated matches {Candida albicans [TaxId: 237561]}
aaelrfcnqtikelmskkhynynfpflapvdtvalnipnyneivkqpmdlgtiqsklann
eyenaddfekdvrlvfkncylfnpegtdvnmmghrleavfdkkw

Timeline for d5n18a1:

• d5n18a1 first appeared in SCOPe 2.06
  
• d5n18a1 appears in SCOPe 2.07