Lineage for d1bg3b3 (1bg3 B:466-670)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2883384Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2884234Family c.55.1.3: Hexokinase [53083] (3 proteins)
  6. 2884256Protein Mammalian type I hexokinase [53086] (2 species)
    further duplication: consists of two very similar lobes
  7. 2884326Species Norway rat (Rattus norvegicus) [TaxId:10116] [53088] (1 PDB entry)
  8. 2884333Domain d1bg3b3: 1bg3 B:466-670 [33497]
    complexed with bgc, ca, g6p

Details for d1bg3b3

PDB Entry: 1bg3 (more details), 2.8 Å

PDB Description: rat brain hexokinase type i complex with glucose and inhibitor glucose-6-phosphate
PDB Compounds: (B:) hexokinase

SCOPe Domain Sequences for d1bg3b3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bg3b3 c.55.1.3 (B:466-670) Mammalian type I hexokinase {Norway rat (Rattus norvegicus) [TaxId: 10116]}
qhrqieetlahfrlskqtlmevkkrlrtememglrketnskatvkmlpsfvrsipdgteh
gdflaldlggtnfrvllvkirsgkkrtvemhnkiysipleimqgtgdelfdhivscisdf
ldymgikgprmplgftfsfpchqtnldcgiliswtkgfkatdceghdvasllrdavkrre
efdldvvavvndtvgtmmtcayeep

SCOPe Domain Coordinates for d1bg3b3:

Click to download the PDB-style file with coordinates for d1bg3b3.
(The format of our PDB-style files is described here.)

Timeline for d1bg3b3: