| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily) core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456 |
Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (9 families) ![]() |
| Family c.124.1.0: automated matches [191609] (1 protein) not a true family |
| Protein automated matches [191112] (17 species) not a true protein |
| Species Myxococcus xanthus [TaxId:246197] [334864] (8 PDB entries) |
| Domain d5n03d_: 5n03 D: [334969] automated match to d1poib_ complexed with act |
PDB Entry: 5n03 (more details), 2.1 Å
SCOPe Domain Sequences for d5n03d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5n03d_ c.124.1.0 (D:) automated matches {Myxococcus xanthus [TaxId: 246197]}
ditpaetvvsllarqiddggvvatgvasplailaiavarathapdltylavvgsldpeip
tllpssedlgyldgrsaeitipdlfdharrgrvdtvffgaaevdaegrtnmtasgsldkp
rtkfpgvagaatlrqwvrrpvllvprqsrrnlvpevqvattrdprrpvtlisdlgvfelg
asgarllarhpwasaahiaertgfafqvsealsvtslpdartvaairaidphgyrdalvg
Timeline for d5n03d_: