Lineage for d5vvwf1 (5vvw F:16-103)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2458695Fold c.5: MurCD N-terminal domain [51983] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; incomplete Rossmann-like fold; binds UDP group
  4. 2458696Superfamily c.5.1: MurCD N-terminal domain [51984] (2 families) (S)
  5. 2458719Family c.5.1.0: automated matches [254240] (1 protein)
    not a true family
  6. 2458720Protein automated matches [254548] (7 species)
    not a true protein
  7. 2458740Species Pseudomonas aeruginosa [TaxId:208964] [334946] (3 PDB entries)
  8. 2458762Domain d5vvwf1: 5vvw F:16-103 [334963]
    Other proteins in same PDB: d5vvwa2, d5vvwa3, d5vvwb2, d5vvwb3, d5vvwc2, d5vvwc3, d5vvwd2, d5vvwd3, d5vvwe2, d5vvwe3, d5vvwf2, d5vvwf3, d5vvwg2, d5vvwg3, d5vvwh2, d5vvwh3
    automated match to d4hv4a1
    complexed with edo

Details for d5vvwf1

PDB Entry: 5vvw (more details), 2.3 Å

PDB Description: structure of murc from pseudomonas aeruginosa
PDB Compounds: (F:) UDP-N-acetylmuramate--L-alanine ligase

SCOPe Domain Sequences for d5vvwf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vvwf1 c.5.1.0 (F:16-103) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
rrihfvgiggagmcgiaevllnlgyevsgsdlkasavterlekfgaqifighqaenadga
dvlvvssainranpevasalerripvvp

SCOPe Domain Coordinates for d5vvwf1:

Click to download the PDB-style file with coordinates for d5vvwf1.
(The format of our PDB-style files is described here.)

Timeline for d5vvwf1: