Lineage for d5wsfa_ (5wsf A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2403751Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2403752Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 2404088Family b.82.1.10: TM1459-like [101976] (3 protein domains)
  6. 2404131Protein automated matches [334958] (1 species)
    not a true protein
  7. 2404132Species Thermotoga maritima [TaxId:243274] [334959] (3 PDB entries)
  8. 2404133Domain d5wsfa_: 5wsf A: [334960]
    automated match to d1vj2a_
    complexed with os

Details for d5wsfa_

PDB Entry: 5wsf (more details), 1.11 Å

PDB Description: crystal structure of a cupin protein (tm1459) in osmium (os)- substituted form ii
PDB Compounds: (A:) Uncharacterized protein tm1459

SCOPe Domain Sequences for d5wsfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5wsfa_ b.82.1.10 (A:) automated matches {Thermotoga maritima [TaxId: 243274]}
milkraydvtpqkistdkvrgvrkrvliglkdapnfvmrlftvepgglidrhshpwehei
fvlkgkltvlkeqgeetveegfyifvepneihgfrndtdseveflclipkegge

SCOPe Domain Coordinates for d5wsfa_:

Click to download the PDB-style file with coordinates for d5wsfa_.
(The format of our PDB-style files is described here.)

Timeline for d5wsfa_: