| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (14 families) ![]() duplication contains two domains of this fold |
| Family c.55.1.3: Hexokinase [53083] (3 proteins) |
| Protein Mammalian type I hexokinase [53086] (2 species) further duplication: consists of two very similar lobes |
| Species Rat (Rattus norvegicus) [TaxId:10116] [53088] (1 PDB entry) |
| Domain d1bg3b2: 1bg3 B:223-465 [33496] |
PDB Entry: 1bg3 (more details), 2.8 Å
SCOP Domain Sequences for d1bg3b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bg3b2 c.55.1.3 (B:223-465) Mammalian type I hexokinase {Rat (Rattus norvegicus) [TaxId: 10116]}
qcevgliigtgtnacymeelrhidlvegdegrmcintewgafgddgsledirtefdreld
rgslnpgkqlfekmvsgmymgelvrlilvkmakegllfegritpelltrgkfntsdvsai
ekdkegiqnakeiltrlgvepsdvdcvsvqhictivsfrsanlvaatlgailnrlrdnkg
tprlrttvgvdgslykmhpqysrrfhktlrrlvpdsdvrfllsesgtgkgaamvtavayr
lae
Timeline for d1bg3b2:
View in 3DDomains from other chains: (mouse over for more information) d1bg3a1, d1bg3a2, d1bg3a3, d1bg3a4 |