![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.72: Ribokinase-like [53612] (3 superfamilies) core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest potential superfamily: members of this fold have similar functions but different ATP-binding sites |
![]() | Superfamily c.72.2: MurD-like peptide ligases, catalytic domain [53623] (3 families) ![]() has extra strand located between strands 1 and 2 |
![]() | Family c.72.2.0: automated matches [254328] (1 protein) not a true family |
![]() | Protein automated matches [254749] (4 species) not a true protein |
![]() | Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [271624] (6 PDB entries) |
![]() | Domain d5vvwe2: 5vvw E:104-318 [334954] Other proteins in same PDB: d5vvwa1, d5vvwa3, d5vvwb1, d5vvwb3, d5vvwc1, d5vvwc3, d5vvwd1, d5vvwd3, d5vvwe1, d5vvwe3, d5vvwf1, d5vvwf3, d5vvwg1, d5vvwg3, d5vvwh1, d5vvwh3 automated match to d4hv4a2 complexed with edo |
PDB Entry: 5vvw (more details), 2.3 Å
SCOPe Domain Sequences for d5vvwe2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5vvwe2 c.72.2.0 (E:104-318) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]} raemlaelmryrhgiavagthgkttttsliasvfaaggldptfviggrlnaagtnaqlga srylvaeadesdasflhlqpmvavvtnidadhmatyggdfnklkktfveflhnlpfygla vmcvddpvvreilpqiarptvtyglsedadvrainirqegmrtwftvlrperepldvsvn mpglhnvlnslativiatdegisdeaivqglsgfq
Timeline for d5vvwe2: