SCOPe 2.06: Domain d5n15c1: 5n15 C:193-319

Lineage for d5n15c1 (5n15 C:193-319)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.2: Bromodomain [47370] (2 families)

5. Family a.29.2.0: automated matches [191428] (1 protein)
   not a true family

6. Protein automated matches [190615] (10 species)
   not a true protein

7. Species Candida albicans [TaxId:5476] [334873] (4 PDB entries)

8. Domain d5n15c1: 5n15 C:193-319 [334944]
   Other proteins in same PDB: d5n15b2, d5n15c2, d5n15d2
   automated match to d5feaa_
   complexed with epe, gol, iod

Details for d5n15c1

PDB Entry: 5n15, 2.37 Å

PDB Description: first bromodomain (bd1) from candida albicans bdf1 in the unbound form

PDB Compounds: (C:) Bromodomain-containing factor 1

SCOPe Domain Sequences for d5n15c1:

Sequence; same for both SEQRES and ATOM records:

>d5n15c1 a.29.2.0 (C:193-319) automated matches {Candida albicans [TaxId: 5476]}
apkppqepdmnnlpenpipqhqakfvlntikavkrnreavpflhpvdtvklnvpfyynyi
prpmdlstierkinlkayedvsqvvddfnlmvknckkfngeaagiskmatniqaqfeklm
vkvppke

Timeline for d5n15c1:

• d5n15c1 is new in SCOPe 2.06-stable
  
• d5n15c1 appears in SCOPe 2.07
  
• d5n15c1 appears in the current release, SCOPe 2.08