Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) duplication contains two domains of this fold |
Family c.55.1.3: Hexokinase [53083] (3 proteins) |
Protein Mammalian type I hexokinase [53086] (2 species) further duplication: consists of two very similar lobes |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [53088] (1 PDB entry) |
Domain d1bg3a4: 1bg3 A:671-911 [33494] complexed with bgc, ca, g6p |
PDB Entry: 1bg3 (more details), 2.8 Å
SCOPe Domain Sequences for d1bg3a4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bg3a4 c.55.1.3 (A:671-911) Mammalian type I hexokinase {Norway rat (Rattus norvegicus) [TaxId: 10116]} tceiglivgtgtnacymeemknvemvegnqgqmcinmewgafgdngclddirtdfdkvvd eyslnsgkqrfekmisgmylgeivrnilidftkkgflfrgqiseplktrgifetkflsqi esdrlallqvrailqqlglnstcddsilvktvcgvvskraaqlcgagmaavvekirenrg ldhlnvtvgvdgtlyklhphfsrimhqtvkelspkctvsfllsedgsgkgaalitavgvr l
Timeline for d1bg3a4:
View in 3D Domains from other chains: (mouse over for more information) d1bg3b1, d1bg3b2, d1bg3b3, d1bg3b4 |