![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily) core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456 |
![]() | Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (9 families) ![]() |
![]() | Family c.124.1.0: automated matches [191609] (1 protein) not a true family |
![]() | Protein automated matches [191112] (17 species) not a true protein |
![]() | Species Myxococcus xanthus [TaxId:246197] [334864] (8 PDB entries) |
![]() | Domain d5n00b_: 5n00 B: [334926] automated match to d1poib_ complexed with act |
PDB Entry: 5n00 (more details), 1.9 Å
SCOPe Domain Sequences for d5n00b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5n00b_ c.124.1.0 (B:) automated matches {Myxococcus xanthus [TaxId: 246197]} ditpaetvvsllarqiddggvvatgvasplailaiavarathapdltylaavgsldpeip tllpssedlgyldgrsaeitipdlfdharrgrvdtvffgaaevdaegrtnmtasgsldkp rtkfpgvagaatlrqwvrrpvllvprqsrrnlvpevqvattrdprrpvtlisdlgvfelg asgarllarhpwasaahiaertgfafqvsealsvtslpdartvaairaidphgyrdalvg
Timeline for d5n00b_: