Class a: All alpha proteins [46456] (289 folds) |
Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily) multihelical; interlocked (homo)dimer |
Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) |
Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins) |
Protein Ethr repressor [109978] (2 species) |
Species Mycobacterium tuberculosis [TaxId:1773] [109979] (34 PDB entries) Uniprot P96222 22-215 |
Domain d5mwoa2: 5mwo A:95-214 [334925] Other proteins in same PDB: d5mwoa1 automated match to d3q0wa2 complexed with edo, j6w |
PDB Entry: 5mwo (more details), 1.96 Å
SCOPe Domain Sequences for d5mwoa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5mwoa2 a.121.1.1 (A:95-214) Ethr repressor {Mycobacterium tuberculosis [TaxId: 1773]} adtdrenmwrtginvffetfgshkavtragqaaratsvevaelwstfmqkwiaytaavid aerdrgaaprtlpahelatalnlmnertlfasfageqpsvpearvldtlvhiwvtsiyge
Timeline for d5mwoa2: