Lineage for d5mwoa2 (5mwo A:95-214)
- Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds) 
Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
multihelical; interlocked (homo)dimerSuperfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) 
Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins) 
Protein Ethr repressor [109978] (2 species) Species Mycobacterium tuberculosis [TaxId:1773] [109979] (65 PDB entries)
Uniprot P96222 22-215
Domain d5mwoa2: 5mwo A:95-214 [334925]
Other proteins in same PDB: d5mwoa1
automated match to d3q0wa2
complexed with edo, j6w
Details for d5mwoa2
PDB Entry: 5mwo (more details), 1.96 Å
PDB Description: structure of mycobacterium tuberculosis transcriptional regulatory repressor protein (ethr) in complex with fragment 7e8.
PDB Compounds: (A:) HTH-type transcriptional regulator EthRSCOPe Domain Sequences for d5mwoa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5mwoa2 a.121.1.1 (A:95-214) Ethr repressor {Mycobacterium tuberculosis [TaxId: 1773]}
adtdrenmwrtginvffetfgshkavtragqaaratsvevaelwstfmqkwiaytaavid
aerdrgaaprtlpahelatalnlmnertlfasfageqpsvpearvldtlvhiwvtsiyge
SCOPe Domain Coordinates for d5mwoa2:
Click to download the PDB-style file with coordinates for d5mwoa2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d5mwoa2:
- d5mwoa2 first appeared in SCOPe 2.06
- d5mwoa2 appears in SCOPe 2.07
View in 3D
