Lineage for d5mwoa2 (5mwo A:95-214)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2727850Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
    multihelical; interlocked (homo)dimer
  4. 2727851Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) (S)
  5. 2727852Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins)
  6. 2727859Protein Ethr repressor [109978] (2 species)
  7. 2727860Species Mycobacterium tuberculosis [TaxId:1773] [109979] (65 PDB entries)
    Uniprot P96222 22-215
  8. 2727912Domain d5mwoa2: 5mwo A:95-214 [334925]
    Other proteins in same PDB: d5mwoa1
    automated match to d3q0wa2
    complexed with edo, j6w

Details for d5mwoa2

PDB Entry: 5mwo (more details), 1.96 Å

PDB Description: structure of mycobacterium tuberculosis transcriptional regulatory repressor protein (ethr) in complex with fragment 7e8.
PDB Compounds: (A:) HTH-type transcriptional regulator EthR

SCOPe Domain Sequences for d5mwoa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mwoa2 a.121.1.1 (A:95-214) Ethr repressor {Mycobacterium tuberculosis [TaxId: 1773]}
adtdrenmwrtginvffetfgshkavtragqaaratsvevaelwstfmqkwiaytaavid
aerdrgaaprtlpahelatalnlmnertlfasfageqpsvpearvldtlvhiwvtsiyge

SCOPe Domain Coordinates for d5mwoa2:

Click to download the PDB-style file with coordinates for d5mwoa2.
(The format of our PDB-style files is described here.)

Timeline for d5mwoa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5mwoa1