Lineage for d5ur1b_ (5ur1 B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2979545Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2979546Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2979693Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2981340Protein Fibroblast growth factor receptor 1 [56158] (1 species)
    PTK group; FGFR subfamily; membrane spanning protein tyrosine kinase
  7. 2981341Species Human (Homo sapiens) [TaxId:9606] [56159] (47 PDB entries)
  8. 2981403Domain d5ur1b_: 5ur1 B: [334923]
    automated match to d4v04b_
    complexed with yy9

Details for d5ur1b_

PDB Entry: 5ur1 (more details), 2.2 Å

PDB Description: fgfr1 kinase domain complex with sn37333 in reversible binding mode
PDB Compounds: (B:) fibroblast growth factor receptor 1

SCOPe Domain Sequences for d5ur1b_:

Sequence, based on SEQRES records: (download)

>d5ur1b_ d.144.1.7 (B:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]}
elpedprwelprdrlvlgkplgegafgqvvlaeaigldkdkpnrvtkvavkmlksdatek
dlsdlisememmkmigkhkniinllgactqdgplyviveyaskgnlreylqarrppgley
synpshnpeeqlsskdlvscayqvargmeylaskkcihrdlaarnvlvtednvmkiadfg
lardihhidyykkttngrlpvkwmapealfdriythqsdvwsfgvllweiftlggspypg
vpveelfkllkeghrmdkpsnctnelymmmrdcwhavpsqrptfkqlvedldrivaltsn

Sequence, based on observed residues (ATOM records): (download)

>d5ur1b_ d.144.1.7 (B:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]}
elpedprwelprdrlvlgkplgegafgqvvlaeaigldkpnrvtkvavkmlksdatekdl
sdlisememmkmigkhkniinllgactqdgplyviveyaskgnlreylqarrpqlsskdl
vscayqvargmeylaskkcihrdlaarnvlvtednvmkiadfglpvkwmapealfdriyt
hqsdvwsfgvllweiftlggspypgvpveelfkllkeghrmdkpsnctnelymmmrdcwh
avpsqrptfkqlvedldrivaltsn

SCOPe Domain Coordinates for d5ur1b_:

Click to download the PDB-style file with coordinates for d5ur1b_.
(The format of our PDB-style files is described here.)

Timeline for d5ur1b_: