![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.17: HMA, heavy metal-associated domain [55008] (2 families) ![]() |
![]() | Family d.58.17.0: automated matches [191590] (1 protein) not a true family |
![]() | Protein automated matches [191063] (9 species) not a true protein |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [334910] (1 PDB entry) |
![]() | Domain d5u9md1: 5u9m D:6-73 [334919] Other proteins in same PDB: d5u9ma_, d5u9mb2, d5u9mc_, d5u9md2 automated match to d1jk9b2 complexed with zn |
PDB Entry: 5u9m (more details), 2.35 Å
SCOPe Domain Sequences for d5u9md1:
Sequence, based on SEQRES records: (download)
>d5u9md1 d.58.17.0 (D:6-73) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} tyeatyaipmhcencvndikaclknvpginslnfdieqqimsvessvapstiintlrncg kdaiirga
>d5u9md1 d.58.17.0 (D:6-73) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} tyeatyaipcencvndikaclknvpginslnfdieqqimsvessvapstiintlrncgkd aiirga
Timeline for d5u9md1:
![]() Domains from other chains: (mouse over for more information) d5u9ma_, d5u9mb1, d5u9mb2, d5u9mc_ |