Lineage for d5u9md1 (5u9m D:6-73)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2516578Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2520807Superfamily d.58.17: HMA, heavy metal-associated domain [55008] (2 families) (S)
  5. 2520941Family d.58.17.0: automated matches [191590] (1 protein)
    not a true family
  6. 2520942Protein automated matches [191063] (8 species)
    not a true protein
  7. 2520945Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [334910] (1 PDB entry)
  8. 2520947Domain d5u9md1: 5u9m D:6-73 [334919]
    Other proteins in same PDB: d5u9ma_, d5u9mb2, d5u9mc_, d5u9md2
    automated match to d1jk9b2
    complexed with zn

Details for d5u9md1

PDB Entry: 5u9m (more details), 2.35 Å

PDB Description: copper-zinc superoxide dismutase is activated through a sulfenic acid intermediate at a copper-ion entry site
PDB Compounds: (D:) superoxide dismutase 1 copper chaperone

SCOPe Domain Sequences for d5u9md1:

Sequence, based on SEQRES records: (download)

>d5u9md1 d.58.17.0 (D:6-73) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
tyeatyaipmhcencvndikaclknvpginslnfdieqqimsvessvapstiintlrncg
kdaiirga

Sequence, based on observed residues (ATOM records): (download)

>d5u9md1 d.58.17.0 (D:6-73) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
tyeatyaipcencvndikaclknvpginslnfdieqqimsvessvapstiintlrncgkd
aiirga

SCOPe Domain Coordinates for d5u9md1:

Click to download the PDB-style file with coordinates for d5u9md1.
(The format of our PDB-style files is described here.)

Timeline for d5u9md1: