SCOPe 2.08: Domain d5u9md1: 5u9m D:6-73

Lineage for d5u9md1 (5u9m D:6-73)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.17: HMA, heavy metal-associated domain [55008] (2 families)

5. Family d.58.17.0: automated matches [191590] (1 protein)
   not a true family

6. Protein automated matches [191063] (9 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [334910] (1 PDB entry)

8. Domain d5u9md1: 5u9m D:6-73 [334919]
   Other proteins in same PDB: d5u9ma_, d5u9mb2, d5u9mc_, d5u9md2
   automated match to d1jk9b2
   complexed with zn

Details for d5u9md1

PDB Entry: 5u9m, 2.35 Å

PDB Description: copper-zinc superoxide dismutase is activated through a sulfenic acid intermediate at a copper-ion entry site

PDB Compounds: (D:) superoxide dismutase 1 copper chaperone

SCOPe Domain Sequences for d5u9md1:

Sequence, based on SEQRES records:

>d5u9md1 d.58.17.0 (D:6-73) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
tyeatyaipmhcencvndikaclknvpginslnfdieqqimsvessvapstiintlrncg
kdaiirga

Sequence, based on observed residues (ATOM records):

>d5u9md1 d.58.17.0 (D:6-73) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
tyeatyaipcencvndikaclknvpginslnfdieqqimsvessvapstiintlrncgkd
aiirga

Timeline for d5u9md1:

• d5u9md1 first appeared in SCOPe 2.06
  
• d5u9md1 appears in SCOPe 2.07