SCOPe 2.08: Domain d5k87b1: 5k87 B:5-185

Lineage for d5k87b1 (5k87 B:5-185)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.21: Diaminopimelate epimerase-like [54505] (1 superfamily)
   mixed beta-sheet folds into a barrel (n=8, S=14) around the central helix

4. Superfamily d.21.1: Diaminopimelate epimerase-like [54506] (5 families)
   duplication: consists of two similar domain swapped with C-terminal strands

5. Family d.21.1.0: automated matches [191386] (1 protein)
   not a true family

6. Protein automated matches [190491] (18 species)
   not a true protein

7. Species Shewanella oneidensis [TaxId:70863] [225314] (3 PDB entries)

8. Domain d5k87b1: 5k87 B:5-185 [334915]
   automated match to d2pw0b1
   complexed with mli

Details for d5k87b1

PDB Entry: 5k87, 1.22 Å

PDB Description: crystal structure of malonate bound to methylaconitate isomerase prpf from shewanella oneidensis

PDB Compounds: (B:) 2-methyl-aconitate isomerase

SCOPe Domain Sequences for d5k87b1:

Sequence; same for both SEQRES and ATOM records:

>d5k87b1 d.21.1.0 (B:5-185) automated matches {Shewanella oneidensis [TaxId: 70863]}
lfppqikvaatymrggtskgvffrlqdlpeaaqvpgpardalllrvigspdpyakqidgm
ggatsstsetvilshsskanhdvdylfgqvsidkpfvdwsgncgnltaavgafaisngli
daariprngvctvriwqanigktiiahvpitdgavqetgdfeldgvtfpaaevqiefmnp
a

Timeline for d5k87b1:

• d5k87b1 first appeared in SCOPe 2.06
  
• d5k87b1 appears in SCOPe 2.07