SCOPe 2.07: Domain d5u9mb1: 5u9m B:8-73

Lineage for d5u9mb1 (5u9m B:8-73)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.17: HMA, heavy metal-associated domain [55008] (2 families)

5. Family d.58.17.0: automated matches [191590] (1 protein)
   not a true family

6. Protein automated matches [191063] (9 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [334910] (1 PDB entry)

8. Domain d5u9mb1: 5u9m B:8-73 [334911]
   Other proteins in same PDB: d5u9ma_, d5u9mb2, d5u9mc_, d5u9md2
   automated match to d1jk9b2
   complexed with zn

Details for d5u9mb1

PDB Entry: 5u9m, 2.35 Å

PDB Description: copper-zinc superoxide dismutase is activated through a sulfenic acid intermediate at a copper-ion entry site

PDB Compounds: (B:) superoxide dismutase 1 copper chaperone

SCOPe Domain Sequences for d5u9mb1:

Sequence, based on SEQRES records:

>d5u9mb1 d.58.17.0 (B:8-73) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
eatyaipmhcencvndikaclknvpginslnfdieqqimsvessvapstiintlrncgkd
aiirga

Sequence, based on observed residues (ATOM records):

>d5u9mb1 d.58.17.0 (B:8-73) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
eatyaicencvndikaclknvpginslnfdieqqimsvessvapstiintldaiirga

Timeline for d5u9mb1:

• d5u9mb1 first appeared in SCOPe 2.06
  
• d5u9mb1 appears in the current release, SCOPe 2.08