SCOPe 2.08: Domain d1bg3a1: 1bg3 A:1-222

Lineage for d1bg3a1 (1bg3 A:1-222)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.3: Hexokinase [53083] (3 proteins)

6. Protein Mammalian type I hexokinase [53086] (2 species)
   further duplication: consists of two very similar lobes

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [53088] (1 PDB entry)

8. Domain d1bg3a1: 1bg3 A:1-222 [33491]
   complexed with bgc, ca, g6p

Details for d1bg3a1

PDB Entry: 1bg3, 2.8 Å

PDB Description: rat brain hexokinase type i complex with glucose and inhibitor glucose-6-phosphate

PDB Compounds: (A:) hexokinase

SCOPe Domain Sequences for d1bg3a1:

Sequence, based on SEQRES records:

>d1bg3a1 c.55.1.3 (A:1-222) Mammalian type I hexokinase {Norway rat (Rattus norvegicus) [TaxId: 10116]}
miaaqllayyftelkddqvkkidkylyamrlsdeilidiltrfkkemknglsrdynptas
vkmlptfvrsipdgsekgdfialdlggssfrilrvqvnheknqnvsmeseiydtpenivh
gsgtqlfdhvadclgdfmekkkikdkklpvgftfsfpcrqskideavlitwtkrfkasgv
egadvvkllnkaikkrgdydanivavvndtvgtmmtcgyddq

Sequence, based on observed residues (ATOM records):

>d1bg3a1 c.55.1.3 (A:1-222) Mammalian type I hexokinase {Norway rat (Rattus norvegicus) [TaxId: 10116]}
miaaqllayyftelkddqvkkidkylyamrlsdeilidiltrfkkemknglsrdynptas
vkmlptfvrsipdgsekgdfialdlggssfrilrvqvnvsmeseiydtpenivhgsgtql
fdhvadclgdfmekkkikdkklpvgftfsfpcrqskideavlitwtkrfkasgvegadvv
kllnkaikkrgdydanivavvndtvgtmmtcgyddq

Timeline for d1bg3a1:

• d1bg3a1 first appeared (with stable ids) in SCOP 1.55
  
• d1bg3a1 appears in SCOPe 2.07