Lineage for d5mxka1 (5mxk A:22-94)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2691778Superfamily a.4.1: Homeodomain-like [46689] (21 families) (S)
    consists only of helices
  5. 2692210Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins)
  6. 2692217Protein Ethr repressor [109651] (2 species)
  7. 2692218Species Mycobacterium tuberculosis [TaxId:1773] [109652] (34 PDB entries)
    Uniprot P96222 22-215
  8. 2692243Domain d5mxka1: 5mxk A:22-94 [334904]
    Other proteins in same PDB: d5mxka2
    automated match to d1t56a1
    complexed with edo, zha

Details for d5mxka1

PDB Entry: 5mxk (more details), 1.93 Å

PDB Description: structure of mycobacterium tuberculosis transcriptional regulatory repressor protein (ethr) in complex with fragment 7g9.
PDB Compounds: (A:) HTH-type transcriptional regulator EthR

SCOPe Domain Sequences for d5mxka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mxka1 a.4.1.9 (A:22-94) Ethr repressor {Mycobacterium tuberculosis [TaxId: 1773]}
gddrelailataenlledrpladisvddlakgagisrptfyfyfpskeavlltlldrvvn
qadmalqtlaenp

SCOPe Domain Coordinates for d5mxka1:

Click to download the PDB-style file with coordinates for d5mxka1.
(The format of our PDB-style files is described here.)

Timeline for d5mxka1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5mxka2