SCOPe 2.08: Domain d5n02b_: 5n02 B:

Lineage for d5n02b_ (5n02 B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily)
   core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456

4. Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (9 families)

5. Family c.124.1.0: automated matches [191609] (1 protein)
   not a true family

6. Protein automated matches [191112] (17 species)
   not a true protein

7. Species Myxococcus xanthus [TaxId:246197] [334864] (8 PDB entries)

8. Domain d5n02b_: 5n02 B: [334900]
   automated match to d1poib_
   complexed with act

Details for d5n02b_

PDB Entry: 5n02, 1.9 Å

PDB Description: crystal structure of the decarboxylase aiba/aibb c56s variant

PDB Compounds: (B:) Glutaconate CoA-transferase family, subunit B

SCOPe Domain Sequences for d5n02b_:

Sequence; same for both SEQRES and ATOM records:

>d5n02b_ c.124.1.0 (B:) automated matches {Myxococcus xanthus [TaxId: 246197]}
ditpaetvvsllarqiddggvvatgvasplailaiavarathapdltylasvgsldpeip
tllpssedlgyldgrsaeitipdlfdharrgrvdtvffgaaevdaegrtnmtasgsldkp
rtkfpgvagaatlrqwvrrpvllvprqsrrnlvpevqvattrdprrpvtlisdlgvfelg
asgarllarhpwasaahiaertgfafqvsealsvtslpdartvaairaidphgyrdalvg
a

Timeline for d5n02b_:

• d5n02b_ first appeared in SCOPe 2.06
  
• d5n02b_ appears in SCOPe 2.07