Lineage for d5lzga_ (5lzg A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2397497Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2397830Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 2397831Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins)
  6. 2398373Protein automated matches [190381] (11 species)
    not a true protein
  7. 2398514Species Vibrio cholerae [TaxId:243277] [313678] (4 PDB entries)
  8. 2398515Domain d5lzga_: 5lzg A: [334899]
    automated match to d5elfd_
    complexed with 7bn, imd, mrd, peg, trs

Details for d5lzga_

PDB Entry: 5lzg (more details), 1.13 Å

PDB Description: cholera toxin el tor b-pentamer in complex with inhibitor pc262
PDB Compounds: (A:) Cholera enterotoxin subunit B

SCOPe Domain Sequences for d5lzga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5lzga_ b.40.2.1 (A:) automated matches {Vibrio cholerae [TaxId: 243277]}
tpqnitdlcaeyhntqiytlndkifsyteslagkremaiitfkngaifqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman

SCOPe Domain Coordinates for d5lzga_:

Click to download the PDB-style file with coordinates for d5lzga_.
(The format of our PDB-style files is described here.)

Timeline for d5lzga_: