SCOPe 2.08: Domain d5n15d1: 5n15 D:193-320

Lineage for d5n15d1 (5n15 D:193-320)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.2: Bromodomain [47370] (2 families)

5. Family a.29.2.0: automated matches [191428] (1 protein)
   not a true family

6. Protein automated matches [190615] (15 species)
   not a true protein

7. Species Yeast (Candida albicans) [TaxId:5476] [334873] (4 PDB entries)

8. Domain d5n15d1: 5n15 D:193-320 [334886]
   Other proteins in same PDB: d5n15b2, d5n15c2, d5n15d2
   automated match to d5feaa_
   complexed with epe, gol, iod

Details for d5n15d1

PDB Entry: 5n15, 2.37 Å

PDB Description: first bromodomain (bd1) from candida albicans bdf1 in the unbound form

PDB Compounds: (D:) Bromodomain-containing factor 1

SCOPe Domain Sequences for d5n15d1:

Sequence; same for both SEQRES and ATOM records:

>d5n15d1 a.29.2.0 (D:193-320) automated matches {Yeast (Candida albicans) [TaxId: 5476]}
apkppqepdmnnlpenpipqhqakfvlntikavkrnreavpflhpvdtvklnvpfyynyi
prpmdlstierkinlkayedvsqvvddfnlmvknckkfngeaagiskmatniqaqfeklm
vkvppkel

Timeline for d5n15d1:

• d5n15d1 first appeared in SCOPe 2.06
  
• d5n15d1 appears in SCOPe 2.07