Class b: All beta proteins [48724] (180 folds) |
Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) |
Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins) |
Protein automated matches [190381] (11 species) not a true protein |
Species Vibrio cholerae [TaxId:243277] [313678] (4 PDB entries) |
Domain d5lzje_: 5lzj E: [334884] automated match to d5elfd_ complexed with 7bt, peg, pge, so4 |
PDB Entry: 5lzj (more details), 1.2 Å
SCOPe Domain Sequences for d5lzje_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5lzje_ b.40.2.1 (E:) automated matches {Vibrio cholerae [TaxId: 243277]} tpqnitdlcaeyhntqiytlndkifsyteslagkremaiitfkngaifqvevpgsqhids qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
Timeline for d5lzje_:
View in 3D Domains from other chains: (mouse over for more information) d5lzja_, d5lzjb_, d5lzjc_, d5lzjd_ |