Lineage for d5n16a1 (5n16 A:193-320)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706693Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2706694Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 2706927Family a.29.2.0: automated matches [191428] (1 protein)
    not a true family
  6. 2706928Protein automated matches [190615] (15 species)
    not a true protein
  7. 2708333Species Yeast (Candida albicans) [TaxId:5476] [334873] (4 PDB entries)
  8. 2708337Domain d5n16a1: 5n16 A:193-320 [334880]
    Other proteins in same PDB: d5n16a2, d5n16b2, d5n16c2, d5n16d2
    automated match to d5feaa_
    complexed with 8fn, gol, ni

Details for d5n16a1

PDB Entry: 5n16 (more details), 1.76 Å

PDB Description: first bromodomain (bd1) from candida albicans bdf1 bound to a dibenzothiazepinone (compound 1)
PDB Compounds: (A:) Bromodomain-containing factor 1

SCOPe Domain Sequences for d5n16a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5n16a1 a.29.2.0 (A:193-320) automated matches {Yeast (Candida albicans) [TaxId: 5476]}
apkppqepdmnnlpenpipqhqakfvlntikavkrnreavpflhpvdtvklnvpfyynyi
prpmdlstierkinlkayedvsqvvddfnlmvknckkfngeaagiskmatniqaqfeklm
vkvppkel

SCOPe Domain Coordinates for d5n16a1:

Click to download the PDB-style file with coordinates for d5n16a1.
(The format of our PDB-style files is described here.)

Timeline for d5n16a1: