Lineage for d1dgkn2 (1dgk N:223-465)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 25007Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
  4. 25008Superfamily c.55.1: Actin-like ATPase domain [53067] (4 families) (S)
  5. 25108Family c.55.1.3: Hexokinase [53083] (2 proteins)
  6. 25113Protein Mammalian type I hexokinase [53086] (2 species)
  7. 25114Species Human (Homo sapiens) [TaxId:9606] [53087] (5 PDB entries)
  8. 25140Domain d1dgkn2: 1dgk N:223-465 [33488]

Details for d1dgkn2

PDB Entry: 1dgk (more details), 2.8 Å

PDB Description: mutant monomer of recombinant human hexokinase type i with glucose and adp in the active site

SCOP Domain Sequences for d1dgkn2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dgkn2 c.55.1.3 (N:223-465) Mammalian type I hexokinase {Human (Homo sapiens)}
hcevgliigtgtnacymeelrhidlvegdegrmcintewgafgddgsledirtefdraid
ayslnpgkqlfekmvsgmylgelvrlilvkmakegllfegritpelltrgkfntsdvsai
eknkeglhnakeiltrlgvepsdddcvsvqhvctivsfrsanlvaatlgailnrlrdnkg
tprlrttvgvdgslykthpqysrrfhktlrrlvpdsdvrfllsesgsgkgaamvtavayr
lae

SCOP Domain Coordinates for d1dgkn2:

Click to download the PDB-style file with coordinates for d1dgkn2.
(The format of our PDB-style files is described here.)

Timeline for d1dgkn2: