Class c: Alpha and beta proteins (a/b) [51349] (97 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) |
Superfamily c.55.1: Actin-like ATPase domain [53067] (4 families) |
Family c.55.1.3: Hexokinase [53083] (2 proteins) |
Protein Mammalian type I hexokinase [53086] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [53087] (5 PDB entries) |
Domain d1dgkn2: 1dgk N:223-465 [33488] |
PDB Entry: 1dgk (more details), 2.8 Å
SCOP Domain Sequences for d1dgkn2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dgkn2 c.55.1.3 (N:223-465) Mammalian type I hexokinase {Human (Homo sapiens)} hcevgliigtgtnacymeelrhidlvegdegrmcintewgafgddgsledirtefdraid ayslnpgkqlfekmvsgmylgelvrlilvkmakegllfegritpelltrgkfntsdvsai eknkeglhnakeiltrlgvepsdddcvsvqhvctivsfrsanlvaatlgailnrlrdnkg tprlrttvgvdgslykthpqysrrfhktlrrlvpdsdvrfllsesgsgkgaamvtavayr lae
Timeline for d1dgkn2: