Lineage for d5mzzb_ (5mzz B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2529545Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily)
    core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456
  4. 2529546Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (9 families) (S)
  5. 2529832Family c.124.1.0: automated matches [191609] (1 protein)
    not a true family
  6. 2529833Protein automated matches [191112] (16 species)
    not a true protein
  7. 2529946Species Myxococcus xanthus [TaxId:246197] [334864] (8 PDB entries)
  8. 2529961Domain d5mzzb_: 5mzz B: [334879]
    automated match to d1poib_
    complexed with 8ew, act, gol

Details for d5mzzb_

PDB Entry: 5mzz (more details), 2.3 Å

PDB Description: crystal structure of the decarboxylase aiba/aibb in complex with 3- methylglutaconate
PDB Compounds: (B:) Glutaconate CoA-transferase family, subunit B

SCOPe Domain Sequences for d5mzzb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mzzb_ c.124.1.0 (B:) automated matches {Myxococcus xanthus [TaxId: 246197]}
ditpaetvvsllarqiddggvvatgvasplailaiavarathapdltylacvgsldpeip
tllpssedlgyldgrsaeitipdlfdharrgrvdtvffgaaevdaegrtnmtasgsldkp
rtkfpgvagaatlrqwvrrpvllvprqsrrnlvpevqvattrdprrpvtlisdlgvfelg
asgarllarhpwasaahiaertgfafqvsealsvtslpdartvaairaidphgyrdalvg
a

SCOPe Domain Coordinates for d5mzzb_:

Click to download the PDB-style file with coordinates for d5mzzb_.
(The format of our PDB-style files is described here.)

Timeline for d5mzzb_: