Lineage for d5lzgd_ (5lzg D:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2788203Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 2788204Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins)
  6. 2788746Protein automated matches [190381] (11 species)
    not a true protein
  7. 2788887Species Vibrio cholerae [TaxId:243277] [313678] (4 PDB entries)
  8. 2788891Domain d5lzgd_: 5lzg D: [334878]
    automated match to d5elfd_
    complexed with 7bn, imd, mrd, peg, trs

Details for d5lzgd_

PDB Entry: 5lzg (more details), 1.13 Å

PDB Description: cholera toxin el tor b-pentamer in complex with inhibitor pc262
PDB Compounds: (D:) Cholera enterotoxin subunit B

SCOPe Domain Sequences for d5lzgd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5lzgd_ b.40.2.1 (D:) automated matches {Vibrio cholerae [TaxId: 243277]}
tpqnitdlcaeyhntqiytlndkifsyteslagkremaiitfkngaifqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman

SCOPe Domain Coordinates for d5lzgd_:

Click to download the PDB-style file with coordinates for d5lzgd_.
(The format of our PDB-style files is described here.)

Timeline for d5lzgd_: