Lineage for d5n18b1 (5n18 B:386-489)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2319937Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2319938Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 2320170Family a.29.2.0: automated matches [191428] (1 protein)
    not a true family
  6. 2320171Protein automated matches [190615] (14 species)
    not a true protein
  7. 2320172Species Candida albicans [TaxId:237561] [334871] (1 PDB entry)
  8. 2320174Domain d5n18b1: 5n18 B:386-489 [334872]
    Other proteins in same PDB: d5n18a2, d5n18b2
    automated match to d2dwwa_
    complexed with 8hz, gol

Details for d5n18b1

PDB Entry: 5n18 (more details), 1.45 Å

PDB Description: second bromodomain (bd2) from candida albicans bdf1 bound to an imidazopyridine (compound 2)
PDB Compounds: (B:) Bromodomain-containing factor 1

SCOPe Domain Sequences for d5n18b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5n18b1 a.29.2.0 (B:386-489) automated matches {Candida albicans [TaxId: 237561]}
aaelrfcnqtikelmskkhynynfpflapvdtvalnipnyneivkqpmdlgtiqsklann
eyenaddfekdvrlvfkncylfnpegtdvnmmghrleavfdkkw

SCOPe Domain Coordinates for d5n18b1:

Click to download the PDB-style file with coordinates for d5n18b1.
(The format of our PDB-style files is described here.)

Timeline for d5n18b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5n18b2