SCOP 1.73: Domain d1dgkn1: 1dgk N:16-222

Lineage for d1dgkn1 (1dgk N:16-222)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (13 families)
   duplication contains two domains of this fold

5. Family c.55.1.3: Hexokinase [53083] (3 proteins)

6. Protein Mammalian type I hexokinase [53086] (2 species)
   further duplication: consists of two very similar lobes

7. Species Human (Homo sapiens) [TaxId:9606] [53087] (5 PDB entries)

8. Domain d1dgkn1: 1dgk N:16-222 [33487]

Details for d1dgkn1

PDB Entry: 1dgk, 2.8 Å

PDB Description: mutant monomer of recombinant human hexokinase type i with glucose and adp in the active site

PDB Compounds: (N:) hexokinase type I

SCOP Domain Sequences for d1dgkn1:

Sequence; same for both SEQRES and ATOM records:

>d1dgkn1 c.55.1.3 (N:16-222) Mammalian type I hexokinase {Human (Homo sapiens) [TaxId: 9606]}
ddqvkkidkylyamrlsdetlidimtrfrkemknglsrdfnptatvkmlptfvrsipdgs
ekgdfialdlggssfrilrvqvnheknqnvhmesevydtpenivhgsgsqlfdhvaeclg
dfmekrkikdkklpvgftfsfpcqqskideailitwtkrfkasgvegadvvkllnkaikk
rgdydanivavvndtvgtmmtcgyddq

Timeline for d1dgkn1:

• d1dgkn1 first appeared (with stable ids) in SCOP 1.55
  
• d1dgkn1 appears in SCOP 1.71
  
• d1dgkn1 appears in SCOP 1.75
  
• d1dgkn1 appears in the current release, SCOPe 2.08