![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.21: Diaminopimelate epimerase-like [54505] (1 superfamily) mixed beta-sheet folds into a barrel (n=8, S=14) around the central helix |
![]() | Superfamily d.21.1: Diaminopimelate epimerase-like [54506] (5 families) ![]() duplication: consists of two similar domain swapped with C-terminal strands |
![]() | Family d.21.1.0: automated matches [191386] (1 protein) not a true family |
![]() | Protein automated matches [190491] (18 species) not a true protein |
![]() | Species Shewanella oneidensis [TaxId:211586] [334856] (1 PDB entry) |
![]() | Domain d5k87a1: 5k87 A:5-185 [334858] automated match to d2pw0b1 complexed with mli |
PDB Entry: 5k87 (more details), 1.22 Å
SCOPe Domain Sequences for d5k87a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5k87a1 d.21.1.0 (A:5-185) automated matches {Shewanella oneidensis [TaxId: 211586]} lfppqikvaatymrggtskgvffrlqdlpeaaqvpgpardalllrvigspdpyakqidgm ggatsstsetvilshsskanhdvdylfgqvsidkpfvdwsgncgnltaavgafaisngli daariprngvctvriwqanigktiiahvpitdgavqetgdfeldgvtfpaaevqiefmnp a
Timeline for d5k87a1: