Lineage for d5k87a1 (5k87 A:5-185)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2939535Fold d.21: Diaminopimelate epimerase-like [54505] (1 superfamily)
    mixed beta-sheet folds into a barrel (n=8, S=14) around the central helix
  4. 2939536Superfamily d.21.1: Diaminopimelate epimerase-like [54506] (5 families) (S)
    duplication: consists of two similar domain swapped with C-terminal strands
  5. 2939665Family d.21.1.0: automated matches [191386] (1 protein)
    not a true family
  6. 2939666Protein automated matches [190491] (18 species)
    not a true protein
  7. 2939736Species Shewanella oneidensis [TaxId:211586] [334856] (1 PDB entry)
  8. 2939737Domain d5k87a1: 5k87 A:5-185 [334858]
    automated match to d2pw0b1
    complexed with mli

Details for d5k87a1

PDB Entry: 5k87 (more details), 1.22 Å

PDB Description: crystal structure of malonate bound to methylaconitate isomerase prpf from shewanella oneidensis
PDB Compounds: (A:) 2-methyl-aconitate isomerase

SCOPe Domain Sequences for d5k87a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5k87a1 d.21.1.0 (A:5-185) automated matches {Shewanella oneidensis [TaxId: 211586]}
lfppqikvaatymrggtskgvffrlqdlpeaaqvpgpardalllrvigspdpyakqidgm
ggatsstsetvilshsskanhdvdylfgqvsidkpfvdwsgncgnltaavgafaisngli
daariprngvctvriwqanigktiiahvpitdgavqetgdfeldgvtfpaaevqiefmnp
a

SCOPe Domain Coordinates for d5k87a1:

Click to download the PDB-style file with coordinates for d5k87a1.
(The format of our PDB-style files is described here.)

Timeline for d5k87a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5k87a2