SCOPe 2.07: Domain d5k6qa3: 5k6q A:460-667

Lineage for d5k6qa3 (5k6q A:460-667)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465

4. Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families)
   there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
   two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules

5. Family c.36.1.9: Pyruvate oxidase and decarboxylase PP module [88749] (8 proteins)
   the N-terminal, Pyr module is separated from the C-terminal, PP module by an alpa/beta domain of Rossmann-like topology

6. Protein Acetohydroxyacid synthase catalytic subunit [88758] (3 species)

7. Species Thale cress (Arabidopsis thaliana), chloroplast [TaxId:3702] [142208] (12 PDB entries)
   Uniprot P17597 460-667

8. Domain d5k6qa3: 5k6q A:460-667 [334842]
   Other proteins in same PDB: d5k6qa1, d5k6qa2
   automated match to d1ybha3
   complexed with fad, mg, nhe, tdm

Details for d5k6qa3

PDB Entry: 5k6q, 2.95 Å

PDB Description: crystal structure of arabidopsis thaliana acetohydroxyacid synthase catalytic subunit

PDB Compounds: (A:) Acetolactate synthase, chloroplastic

SCOPe Domain Sequences for d5k6qa3:

Sequence; same for both SEQRES and ATOM records:

>d5k6qa3 c.36.1.9 (A:460-667) Acetohydroxyacid synthase catalytic subunit {Thale cress (Arabidopsis thaliana), chloroplast [TaxId: 3702]}
eaippqyaikvldeltdgkaiistgvgqhqmwaaqfynykkprqwlssgglgamgfglpa
aigasvanpdaivvdidgdgsfimnvqelatirvenlpvkvlllnnqhlgmvmqwedrfy
kanrahtflgdpaqedeifpnmllfaaacgipaarvtkkadlreaiqtmldtpgpylldv
icphqehvlpmipsggtfndvitegdgr

Timeline for d5k6qa3:

• d5k6qa3 first appeared in SCOPe 2.06
  
• d5k6qa3 appears in the current release, SCOPe 2.08